SAB2103331

Anti-MSX2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-CRS2, Anti-FPP, Anti-HOX8, Anti-MSH, Anti-PFM
• Numer MDL: MFCD01633881
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 29 kDa
• reaktywność gatunkowa: bovine, horse, dog, human
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunofluorescence: suitable; western blot: suitable
• numer dostępu NCBI: NM_002449
• numer dostępu UniProt: P35548
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... MSX2(4488)

Opis

Immunogen

Synthetic peptide directed towards the n terminal region of human MSX2

Działania biochem./fizjol.

MSX2 probable play a morphogenetic role. MSX2 may play a role in limb-pattern formation. In osteoblasts, MSX2 suppresses transcription driven by the osteocalcin FGF response element (OCFRE).This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sekwencja

Synthetic peptide located within the following region: MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable