Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Kluczowe dokumenty

SAB1410565

Sigma-Aldrich

Anti-CYP4V2 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonim(y):

BCD, CYP4AH1, FLJ18432, MGC43534

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych

Wybierz wielkość

100 μG
2220,00 zł

2220,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności


Wybierz wielkość

Zmień widok
100 μG
2220,00 zł

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

2220,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

antigen 60.7 kDa

reaktywność gatunkowa

human

metody

western blot: 1 μg/mL

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... CYP4V2(285440)

Opis ogólny

Cytochrome P450 4V2 (CYP4V2) belongs to human cytochrome P450 enzyme family and encodes a protein of 55 kDa. CYP4V2 gene is mapped to human chromosome 4q35.1−q35.2. CYP4V2 is majorly expressed in the epithelial cells of the retina and cornea. In retinal pigment epithelia (RPE) cell lines, the enzyme is localized to endoplasmic reticulum.
This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy. (provided by RefSeq)

Immunogen

CYP4V2 (NP_997235.2, 1 a.a. ~ 525 a.a) full-length human protein.

Sequence
MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLKILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER

Działania biochem./fizjol.

Cytochrome P450 4V2 (CYP4V2) is involved in the fatty acid ω-hydroxylation. It alters lipid homeostasis when expressed in human liver cancer HepG2 cells. It coordinates with enzymes involved in mitochondrial and peroxisomal α/β-oxidation. Functional CYP4V2 gene mutant is implicated in ocular disease called the Bietti crystalline dystrophy. It is also expressed in macrophages and is regulated by nuclear receptor peroxisome proliferator activated receptor γ (PPARγ).

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Expression of CYP4V2 in human THP1 macrophages and its transcriptional regulation by peroxisome proliferator-activated receptor gamma
Yi M, et al.
Toxicology and Applied Pharmacology, 330(5), 100-106 (2017)
CYP4V2 in Bietti's crystalline dystrophy: ocular localization, metabolism of omega-3-polyunsaturated fatty acids, and functional deficit of the p. H331P variant
Nakano M, et al.
Molecular Pharmacology, 82(4), 679-686 (2012)
Expression and characterization of CYP4V2 as a fatty acid omega-hydroxylase
Nakano M, et al.
Drug Metabolism and Disposition, 37(11), 2119-2122 (2009)
Erin L Heinzen et al.
American journal of human genetics, 86(5), 707-718 (2010-04-20)
Deletions at 16p13.11 are associated with schizophrenia, mental retardation, and most recently idiopathic generalized epilepsy. To evaluate the role of 16p13.11 deletions, as well as other structural variation, in epilepsy disorders, we used genome-wide screens to identify copy number variation
Jiang-Hui Wang et al.
Scientific reports, 12(1), 9525-9525 (2022-06-11)
Bietti crystalline dystrophy (BCD) is an inherited retinal disease (IRD) caused by mutations in the CYP4V2 gene. It is a relatively common cause of IRD in east Asia. A number of features of this disease make it highly amenable to

Questions

Reviews

No rating value

Active Filters

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej