SAB1409010

Monoclonal Anti-FOXF2 antibody produced in mouse

clone 4F8, purified immunoglobulin, buffered aqueous solution

• Synonim(y): FKHL6, FREAC2
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 4F8, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen 40.37 kDa
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu NCBI: NM_001452
• numer dostępu UniProt: Q12947
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... FOXF2(2295)

Opis

Opis ogólny

FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. (provided by RefSeq)

Immunogen

FOXF2 (NP_001443, 207 a.a. ~ 340 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YHRVVSGLGFGASLLPQGFDFQAPPSAPLGCHSQGGYGGLDMMPAGYDAGAGAPSHAHPHIECHSPYTSPAAHW

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable