SAB1408787

Monoclonal Anti-TNFSF13B antibody produced in mouse

clone 3G6, purified immunoglobulin, buffered aqueous solution

• Synonim(y): BAFF, BLYS, CD257, DTL, TALL-1, TALL1, THANK, TNFSF20, ZTNF4
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 3G6, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen 37.18 kDa
• reaktywność gatunkowa: human
• metody: immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2aκ
• numer dostępu NCBI: BC020674
• numer dostępu UniProt: Q9Y275
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... TNFSF13B(10673)

Opis

Opis ogólny

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. (provided by RefSeq)

Immunogen

TNFSF13B (AAH20674.1, 118 a.a. ~ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGD

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable