SAB1404585

Monoclonal Anti-CILP antibody produced in mouse

clone 2D10, purified immunoglobulin, buffered aqueous solution

• Synonim(y): CILP-1, HsT18872
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 2D10, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~36.89 kDa
• reaktywność gatunkowa: human
• metody: capture ELISA: suitable; indirect ELISA: suitable
• izotyp: IgG2aκ
• numer dostępu NCBI: NM_003613
• numer dostępu UniProt: O75339
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... CILP(8483)

Opis

Opis ogólny

Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. The encoded protein was thought to encode a protein precursor for 2 different proteins, namely CILP and a homolog of NTPPHase, however later studies identified no nucleotide pyrophosphatase phosphodiesterase (NPP) activity. One isoform of the protein, CILP-1, functions as an IGF-1 antagonist. (provided by RefSeq)

Immunogen

CILP (NP_003604, 129 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 13 - Non Combustible Solids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable