SAB1404374

Monoclonal Anti-SLC2A4, (C-terminal) antibody produced in mouse

clone 1F12, purified immunoglobulin, buffered aqueous solution

• Synonim(y): GLUT4
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 1F12, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~30.84 kDa
• reaktywność gatunkowa: human
• metody: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2aκ
• numer dostępu NCBI: NM_001042
• numer dostępu UniProt: P14672
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SLC2A4(6517)

Opis

Opis ogólny

This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). (provided by RefSeq)

Immunogen

SLC2A4 (NP_001033, 467 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable