SAB1403587

Monoclonal Anti-ATP2A1 antibody produced in mouse

clone 6F8, purified immunoglobulin, buffered aqueous solution

• Synonim(y): ATP2A, SERCA1
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 6F8, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~36.12 kDa
• reaktywność gatunkowa: human
• metody: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu NCBI: NM_173201
• numer dostępu UniProt: O14983
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ATP2A1(487)

Opis

Opis ogólny

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms. (provided by RefSeq)

Immunogen

ATP2A1 (NP_775293, 522 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable