SAB1403380

Monoclonal Anti-DUSP16, (C-terminal) antibody produced in mouse

clone 3F3, purified immunoglobulin, buffered aqueous solution

• Synonim(y): KIAA1700, MGC129701, MGC129702, MKP-7, MKP7
• Kod UNSPSC: 12352203
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 3F3, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~37.66 kDa
• reaktywność gatunkowa: human
• metody: capture ELISA: suitable; indirect ELISA: suitable
• izotyp: IgG2aκ
• numer dostępu NCBI: NM_030640
• numer dostępu UniProt: Q9BY84
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... DUSP16(80824)

Opis

Opis ogólny

The activation of mitogen-activated protein kinase (MAPK) cascades transduces various extracellular signals to the nucleus to induce gene expression, cell proliferation, differentiation, cell cycle arrest, and apoptosis. For full activation of MAPKs, dual-specificity kinases phosphorylate both threonine and tyrosine residues in MAPK TXY motifs. MKPs are dual-specificity phosphatases that dephosphorylate the TXY motif, thereby negatively regulating MAPK activity.[supplied by OMIM

Immunogen

DUSP16 (NP_085143.1, 561 a.a. ~ 665 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSMEIIEVS

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable