QPREST27836

SILu^™PrEST ZCPW2

SILuPrESTs Powered by Atlas Antibodies, buffered aqueous solution

• Kod UNSPSC: 12352200

Właściwości

• rekombinowane: expressed in E. coli LysA ArgA BL21(DE3)
• Próba: >80% (SDS-PAGE)
• Postać: buffered aqueous solution
• masa cząsteczkowa: predicted mol wt 26kDa including tags
• oczyszczone przez: immobilized metal affinity chromatography (IMAC)
• opakowanie: pkg of 1nmol × 5 vials
• warunki przechowywania: avoid repeated freeze/thaw cycles
• sekwencja immunogenna: TATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF
• numer dostępu UniProt: Q504Y3
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... ZCPW2(152098)

Opis

Opis ogólny

Lys, Arg ¹³C and ¹⁵N metabolically labeled recombinant human protein fragment

Zastosowanie

Internal standard in MS-based quantitative proteomics

Postać fizyczna

Heavy proteins are provided in solution of 1M Urea PBS, pH 7.4

Uwaga dotycząca przygotowania

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Komentarz do analizy

Isotopic Label Incorporation

The SILuPrEST standards are produced using metabolic labeling with heavy isotope labeled (15N, 13C) Lysine and Arginine residues, with greater than 99% isotopic label incorporation.

A purification and quantification tag (QTag) consisting of a hexahistidine (His6) sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G.

All SILuPrESTs contain an N-terminal His6ABP fusion tag, used for accurate determination of concentration. The fusion tag sequence is:

GSSHHHHHHSSGLVPRGSHMASLAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGTFAHYMDPNSSSVDKLAAA.

The specific human protein sequence begins directly after ′VDKLAAA′.

Informacje prawne

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com

SILu is a trademark of Sigma-Aldrich Co. LLC

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 12 - Non Combustible Liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable