Wszystkie zdjęcia(1)
Key Documents
MSST0044
SILu™Lite TIMP1, Metalloproteinase inhibitor 1 human
recombinant, expressed in HEK 293 cells, MS Protein Standard
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
23201100
NACRES:
NA.12
Opis ogólny
SILu™Lite TIMP1 is a recombinant human protein expressed in human 293 cells. It consists of 184 amino acids, with a calculated molecular mass of 20.7 kDa. SILu™Lite TIMP1 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Działania biochem./fizjol.
TIMP-1 is glycoprotein that is over-expressed in the supernatant of tissue extracts of breast, gastric, colorectal, and hepatocellular carcinomas. It belongs to the family of “tissue inhibitors of metalloproteinases,” a group of proteins that help regulate bone turnover. TIMP-1 serum levels are significantly associated with HER2 extracellular domain (ECD)-positivity and poorer disease-free survival among primary breast cancer patients with HER2 overexpression. High levels of serum TIMP-1 correlate with advanced disease and predict for poor survival in patients with multiple myeloma treated with bortezomib and/or IMiDs during their disease course.
Sekwencja
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Postać fizyczna
Supplied as a lyophilized powder containing phosphate buffered saline.
Informacje prawne
SILu is a trademark of Sigma-Aldrich Co. LLC
This page may contain text that has been machine translated.
Kod klasy składowania
11 - Combustible Solids
Klasa zagrożenia wodnego (WGK)
WGK 2
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej