Przejdź do zawartości
Merck
Wszystkie zdjęcia(6)

Kluczowe dokumenty

HPA042451

Sigma-Aldrich

Anti-SETD2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

Przeciwciało Setd2, Przeciwciało Setd2 - przeciwciało anty-SETD2 produkowane u królików

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych

Wybierz wielkość

100 μL
2440,00 zł

2440,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności


Wybierz wielkość

Zmień widok
100 μL
2440,00 zł

About This Item

Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
NACRES:
NA.43

2440,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Formularz

buffered aqueous glycerol solution

reaktywność gatunkowa

human

metody

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

sekwencja immunogenna

NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SETD2(29072)

Opis ogólny

SET domain containing 2 (SETD2) is a histone methyltransferase gene and is mapped on human chromosome 3p21.31, a region associated with growth arrest of cancer cells.

Immunogen

SET domain containing 2 recombinant protein epitope signature tag (PrEST)

Zastosowanie

All Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-SETD2 antibody produced in rabbit has been used in immunohistochemistry.

Działania biochem./fizjol.

SET domain containing 2 (SETD2) plays a vital role in trimethylation of the histone mark H3K36 (histone 3 lysine 36). Mutation of this tumor suppressor gene (TSG) is associated with the pathogenesis of various cancers including, clear cell renal cell carcinoma (cRCC), breast cancer, lung cancer, acute lymphoblastic leukemia(ALL), and glioma. In addition, SETD2 gene is also involved in the development of Huntington′s disease (HD). SETD2 plays an important role in the transcriptional elongation by maintaining chromatin structure through association with hyperphosphorylated RNA polymerase II (POLR2A). SETD2 interacts with p53 and acts as a tumor suppressor in breast cancer cells. SETD2 is implicated in DNA double-strand break (DSB) exclusion and homologous recombination (HR) repair in human cells. SETD2 in HeLa cells alters nucleosome organization via decreasing the recruitment of the FACT (facilitates chromatin transcription) complex to active genes.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST79513

Postać fizyczna

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Kathryn E Hacker et al.
The Journal of biological chemistry, 291(40), 21283-21295 (2016-08-17)
The yeast Set2 histone methyltransferase is a critical enzyme that plays a number of key roles in gene transcription and DNA repair. Recently, the human homologue, SETD2, was found to be recurrently mutated in a significant percentage of renal cell
Jiaming Li et al.
Frontiers in genetics, 11, 794-794 (2020-08-28)
Recent studies have shown that myelodysplastic syndrome's (MDS) progression to acute myeloid leukemia (AML) is associated with gene mutations. SET domain containing 2 (SETD2) variants were reported as a risk factor of poor prognosis in patients with AML. However, little
G Martinelli et al.
Leukemia, 32(1), 139-148 (2017-07-01)
The molecular basis of advanced systemic mastocytosis (SM) is not fully understood and despite novel therapies the prognosis remains dismal. Exome sequencing of an index-patient with mast cell leukemia (MCL) uncovered biallelic loss-of-function mutations in the SETD2 histone methyltransferase gene.
The mRNA expression of SETD2 in human breast cancer: correlation with clinico-pathological parameters.
Al Sarakbi W
BMC Cancer null
Type II enteropathy-associated T-cell lymphoma features a unique genomic profile with highly recurrent SETD2 alterations.
Roberti A
Nature Communications null

Questions

Reviews

No rating value

Active Filters

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej