HPA036561

Anti-SCLT1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-FLJ30655, Anti-HCAP-1A, Anti-Sodium channel and clathrin linker 1
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA036561
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Formularz: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• metody: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• sekwencja immunogenna: KTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLTKQLHVTNENMEVTNQQFLKTVTEQSVIIE
• numer dostępu UniProt: Q96NL6
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SCLT1(132320)

Opis

Opis ogólny

Sodium channel and clathrin linker 1 (SCLT1)/clathrin-associated protein-1A (CAP-1A) is an important protein that has distinct domains. It is expressed in DRG (dorsal root ganglion) neurons. SCLT1 gene is located on human chromosome 4q28.2.

Immunogen

sodium channel and clathrin linker 1 recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-SCLT1 antibody has been used in immunostaining[1] and indirect immunofluorescence.

Działania biochem./fizjol.

The domains of sodium channel and clathrin linker 1 (SCLT1)/clathrin-associated protein-1A (CAP-1A) has the ability to bind and form a multiprotein complex with Na(v)1.8 and clathrin. Lack of SCLT1 results in cystic kidney. It induces membrane docking and is essential for ciliogenesis.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST79787

Postać fizyczna

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable