HPA023087
Anti-GLRX2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
Anti-Glutaredoxin-2, mitochondrial
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Formularz
buffered aqueous glycerol solution
reaktywność gatunkowa
human
metody
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
sekwencja immunogenna
DMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... GLRX2(51022)
Opis ogólny
GLRX2 (glutaredoksyna 2) należy do nadrodziny oksydoreduktaz tiolowo-disiarczkowych Trx (tioredoksyny). Białko ma nietypowy motyw miejsca aktywnego i dwie dodatkowe cysteiny, które uczestniczą w tworzeniu wiązania disiarczkowego. Białko jest obecne w mitochondriach i ma masę 18 kDa. Gen jest zmapowany na ludzkim chromosomie 1q31.
Immunogen
Glutaredoxin-2, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Zastosowanie
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Działania biochem./fizjol.
GLRX (glutaredoksyny) biorą udział w deglutationylacji białek docelowych. S-glutationylacja białek jest kluczowa dla sygnalizacji tiolowo-redoksowej w procesach komórkowych. GRX2 jest związany z białkami tiolowymi błony mitochondrialnej. Regulacja w górę GLRX2 hamuje śmierć komórek za pośrednictwem nadtlenku wodoru i chroni aktywność kompleksu I w mitochondriach.
Cechy i korzyści
Prestige Antibodies® to wysoce scharakteryzowane i wszechstronnie zwalidowane przeciwciała z dodatkową korzyścią w postaci wszystkich dostępnych danych dotyczących charakterystyki każdego celu, które są dostępne za pośrednictwem portalu Human Protein Atlas, do którego link znajduje się tuż pod nazwą produktu na górze tej strony. Wyjątkowość i niska reaktywność krzyżowa przeciwciał Prestige Antibodies® z innymi białkami wynika z dokładnego doboru regionów antygenowych, oczyszczania metodą powinowactwa i rygorystycznej selekcji. Kontrole antygenów Prestige są dostępne dla każdego odpowiedniego przeciwciała Prestige i można je znaleźć w sekcji powiązań.
Każde przeciwciało Prestige jest testowane w następujący sposób:
Każde przeciwciało Prestige jest testowane w następujący sposób:
- Macierz tkankowa IHC 44 normalnych tkanek ludzkich i 20 najczęściej występujących tkanek nowotworowych.
- Macierz białkowa 364 ludzkich rekombinowanych fragmentów białkowych.
Powiązanie
Odpowiadający antygen APREST74232
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Nie widzisz odpowiedniej wersji?
Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Huihui Zhang et al.
Antioxidants & redox signaling, 21(5), 669-681 (2013-12-04)
Mitochondrial thioredoxin (Trx) is critical for defense against oxidative stress-induced cell apoptosis. To date, mitochondrial thioredoxin reductase (TrxR) is the only known enzyme catalyzing Trx2 reduction in mitochondria. However, TrxR is sensitive to inactivation by exo/endogenous electrophiles, for example, 4-hydroxynonenal
Christoph Hudemann et al.
Antioxidants & redox signaling, 11(1), 1-14 (2008-08-19)
Glutaredoxin 2 (Grx2) is a glutathione-dependent oxidoreductase involved in the maintenance of mitochondrial redox homeostasis. Grx2 was first characterized as mitochondrial protein, but alternative mRNA variants lacking the transit peptide-encoding first exon were demonstrated for human and proposed for mouse.
Hongli Wu et al.
Biochimica et biophysica acta, 1797(10), 1705-1715 (2010-06-16)
Glutaredoxin 2 (Grx2) belongs to the oxidoreductase family and is an isozyme of glutaredoxin 1 (Grx1) present in the mitochondria, however its function is not well understood. The purpose of this study is to evaluate the potential anti-apoptotic function of
Juan Ignacio Romero et al.
Biochimica et biophysica acta, 1850(6), 1274-1285 (2015-03-05)
Thioredoxin (Trx) family proteins are crucial mediators of cell functions via regulation of the thiol redox state of various key proteins and the levels of the intracellular second messenger hydrogen peroxide. Their expression, localization and functions are altered in various
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej