HPA017000

Anti-UTS2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-U-II, Anti-UII, Anti-Urotensin-2 precursor, Anti-Urotensin-II
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA017000
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• metody: immunohistochemistry: 1:50- 1:200
• sekwencja immunogenna: TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
• numer dostępu UniProt: O95399
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... UTS2(10911)

Opis

Opis ogólny

UTS2 (urotensin 2) is a vasoactive molecule with a cyclic structure of 11 amino acids. It is expressed in various tissues of human body.

Immunogen

Urotensin-2 precursor recombinant protein epitope signature tag (PrEST)

Zastosowanie

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Działania biochem./fizjol.

UTS2 (urotensin 2) is involved in the cell growth and proliferation of the vascular smooth muscle cell. It acts as an endogenous ligand for the orphan G-protein-coupled receptor (GPR 14). It has been studied that UTS2 associates with the menopausal status, and extra-nodal and lymphatic invasion. Research has proved that UTS2 and its receptors have strong correlation with breast cancers. It has also clinicopathological imppact on the cardiovascular physiology and pathophysiology. Thus, studies show upregulation of UII expression in acute coronary syndrome (ACS).

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86786

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)