Przejdź do zawartości
Merck
Wszystkie zdjęcia(7)

Kluczowe dokumenty

HPA001238

Sigma-Aldrich

Anti-MMP9 antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

CLG4B

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych

Wybierz wielkość

100 μL
2370,00 zł

2370,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności


Wybierz wielkość

Zmień widok
100 μL
2370,00 zł

About This Item

Numer MDL:
Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
NACRES:
NA.43

2370,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności

pochodzenie biologiczne

rabbit

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Formularz

buffered aqueous glycerol solution

reaktywność gatunkowa

human

rozszerzona walidacja

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

metody

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

numer dostępu UniProt

Zastosowanie

research pathology

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... MMP9(4318)

Opis ogólny

Matrix metalloproteinase-9 (MMP-9) is a pro-inflammatory, zinc-dependent proteinase, which is also known as 92kDa gelatinase. It is secreted by granulocytes and mononuclear cells. The activity of MMP-9 is controlled by gene transcription. The gene encoding it is localized on human chromosome 20q11.2-q13.1 and has 13 exons.

Immunogen

Recombinant protein corresponding to Matrix metalloproteinase-9

Sequence
PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI

Zastosowanie

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MMP9 antibody produced in rabbit has been used in:
  • immunohistochemistry
  • western blotting
  • fluorescence immunohistochemistry

Działania biochem./fizjol.

Matrix metalloproteinase-9 (MMP-9) catalyzes the degradation of gelatin and collagen. It has been studied as a biomarker for inflammation in multiple sclerosis (MS). The MMP9 protein is a zinc-dependent protease which is responsible for degradation of extracellular matrix components. It also participates in the pathogenesis of cancers.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST83039

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

David G P van IJzendoorn et al.
Clinical cancer research : an official journal of the American Association for Cancer Research (2022-08-26)
A major component of cells in Tenosynovial Giant Cell Tumor (TGCT) consists of bystander macrophages responding to CSF1 that is overproduced by a small number of neoplastic cells with a chromosomal translocation involving the CSF1 gene. An autocrine loop was
Association between four MMP-9 polymorphisms and breast cancer risk: a meta-analysis.
Zhang X, et al.
Medical Science Monitor : International Medical Journal of Experimental and Clinical Research, 21(16), 1115-1115 (2015)
HDAC10 suppresses cervical cancer metastasis through inhibition of matrix metalloproteinase (MMP) 2 and 9 expression.
Song C, et al.
The Journal of Biological Chemistry, 13(6), M113-M113 (2013)
Local influence of high molecular polyethylene particles on heterotopic ossification.
Zeng Lin-Ru, et al.
Experimental and Therapeutic Medicine, 13(6), 2934-2938 (2017)
Julie A Bass et al.
BMC gastroenterology, 15, 129-129 (2015-10-16)
Early manifestations of pediatric inflammatory bowel disease (IBD) can be relatively nonspecific. Initial mucosal biopsies may not be conclusive, delaying the diagnosis until subsequent biopsies demonstrate typical histologic features of IBD. We hypothesized that certain inflammatory cell types may be

Questions

Reviews

No rating value

Active Filters

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej