HPA000653
Anti-VASH1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
Anti-Vasohibin-1 antibody produced in rabbit
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
pochodzenie biologiczne
rabbit
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Formularz
buffered aqueous glycerol solution
reaktywność gatunkowa
human
rozszerzona walidacja
recombinant expression
Learn more about Antibody Enhanced Validation
metody
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
sekwencja immunogenna
GALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPD
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... VASH1(22846)
Immunogen
Vasohibin-1 recombinant protein epitope signature tag (PrEST)
Zastosowanie
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Działania biochem./fizjol.
Vasohibin-1 jest białkiem kodowanym przez gen VASH1 u ludzi. Jest to inhibitor angiogenezy, który ulega specyficznej ekspresji w ludzkich komórkach śródbłonka naczyniowego w odpowiedzi na czynnik wzrostu śródbłonka naczyniowego i czynnik wzrostu fibroblastów-2. Działa jako pochodzący ze śródbłonka regulator ujemnego sprzężenia zwrotnego angiogenezy. Jest indukowany przez czynnik wzrostu fibroblastów 2 (FGF-2) i czynnik wzrostu śródbłonka naczyniowego A (VEGF-A). Gen ten jest związany z angiogenezą i złym rokowaniem w kilku typach nowotworów. Nadekspresja tego genu w komórkach raka jelita grubego (CRC) zwiększa potencjał złośliwości i promuje przerzuty. Wazohibina-1 może działać jako nowy biomarker dostarczający dodatkowych informacji prognostycznych u pacjentów z rakiem jelita grubego.
Cechy i korzyści
4357 to wysoce scharakteryzowane i wszechstronnie zwalidowane przeciwciała z dodatkową korzyścią w postaci wszystkich dostępnych danych dotyczących charakterystyki każdego celu, które są dostępne za pośrednictwem portalu Human Protein Atlas, do którego link znajduje się tuż pod nazwą produktu na górze tej strony. Wyjątkowość i niska reaktywność krzyżowa przeciwciał 4357 z innymi białkami wynika z dokładnego doboru regionów antygenowych, oczyszczania metodą powinowactwa i rygorystycznej selekcji. Kontrole antygenów Prestige są dostępne dla każdego odpowiedniego przeciwciała Prestige i można je znaleźć w sekcji powiązań.
Każde przeciwciało Prestige jest testowane w następujący sposób:
Każde przeciwciało Prestige jest testowane w następujący sposób:
- Macierz tkankowa IHC 44 normalnych tkanek ludzkich i 20 najczęściej występujących tkanek nowotworowych.
- Macierz białkowa 364 ludzkich rekombinowanych fragmentów białkowych.
Powiązanie
Odpowiadający antygen APREST70356
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Oświadczenie o zrzeczeniu się odpowiedzialności
O ile nie określono inaczej w naszym katalogu lub innej dokumentacji firmy dołączonej do produktu(-ów), nasze produkty są przeznaczone wyłącznie do użytku badawczego i nie mogą być wykorzystywane do żadnych innych celów, w tym między innymi do nieautoryzowanych zastosowań komercyjnych, zastosowań diagnostycznych in vitro, zastosowań terapeutycznych ex vivo lub in vivo lub jakiegokolwiek rodzaju konsumpcji lub zastosowania u ludzi lub zwierząt.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Nie widzisz odpowiedniej wersji?
Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Tao Zhang et al.
Medical oncology (Northwood, London, England), 31(5), 963-963 (2014-04-22)
Vasohibin-1 (VASH1) is a newly discovered angiogenesis inhibitor that is specifically expressed in human vascular endothelial cells in response to vascular endothelial growth factor and fibroblast growth factor-2. This study aimed to evaluate the expression of VASH1 in non-small cell
Takahito Kitajima et al.
Anticancer research, 34(10), 5321-5329 (2014-10-03)
Vasohibin-1 (VASH1) is related to angiogenesis and poor prognosis in several types of cancers. However, the biological function and clinical significance of VASH1 in colorectal cancer (CRC) are not fully known. The associations between VASH1 expression and clinicopathological features were
Yichao Yan et al.
Medical oncology (Northwood, London, England), 31(2), 816-816 (2013-12-25)
Vasohibin-1 has been recently detected in endothelial cells and identified as a negative feedback regulator of angiogenesis induced by VEGF-A. However, the expression of Vasohibin-1 in colorectal cancer and its correlations with VEGF-A, microvessel density (MVD), and the prognosis of
Keigo Murakami et al.
Human pathology, 45(3), 589-597 (2014-01-22)
Vasohibin 1, an endothelium-derived negative feedback regulator of angiogenesis, is induced by fibroblast growth factor 2 (FGF-2) and vascular endothelial growth factor A (VEGF-A). In this study, we retrospectively evaluated immunoreactivity of FGF-2 and VEGF-A as well as microvessel density
T Kosaka et al.
British journal of cancer, 108(10), 2123-2129 (2013-04-18)
We recently isolated vasohibin-1 (VASH1), a novel angiogenic molecule that is specifically expressed in activated vascular endothelial cells (ECs), and the status of VASH1 expression has been documented in various cancer angiogenesis. The aim of this study was to assess
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej