Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Dokumenty

AV54274

Sigma-Aldrich

Anti-ATG10 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-APG10, Anti-APG10L, Anti-ATG10 autophagy related 10 homolog (S. cerevisiae), Anti-DKFZP586I0418, Anti-FLJ13954, Anti-Pp12616

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

25 kDa

reaktywność gatunkowa

mouse, rat, human

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_113670

numer dostępu UniProt

Q9H0Y0

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... ATG10(83734)

Powiązane kategorie

Opis ogólny

ATG10 [autophagy related 10 homolog (S. cerevisiae)] or APG10 gene encodes a protein necessary for autophagy in yeast. Autophagy is a catabolic cellular event that includes cell death of superfluous or dysfunctional cellular components, cell differentiation and aging. It is also crucial for the maintenance of amino acid levels and protein synthesis under nitrogen starvation and is enhanced under certain conditions such as hormonal stimulation and drug treatments.

Immunogen

Synthetic peptide directed towards the C terminal region of human ATG10

Zastosowanie

Anti-ATG10 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Działania biochem./fizjol.

Atg10 is an E2-like enzyme that facilitates the addition of ubiquitination modifications essential for autophagosome formation. It catalyzes the conjugation of ATG12 to ATG5, which is essential for proper localization of ATG8 to the preautophagosomal structure (PAS). Further, Atg10 also plays a role in modifying the soluble form of LC3 to the membrane-bound form during Atg12 conjugation.

Sekwencja

Synthetic peptide located within the following region: TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Miao-Qing Zhang et al.
Frontiers in immunology, 9, 2176-2176 (2018-10-16)
Autophagy-related 10 (ATG10) is essential for autophagy since it promotes ATG5-ATG12 complex formation. Our previous study found that there are two isoforms of the ATG10 protein, ATG10 (a longer one) and ATG10S, which have identical sequences except an absence of
[The nurse; cancerology and radiotherapy].
C Chenal et al.
Revue de l'infirmiere, 26(8), 686-695 (1976-10-01)
N Mizushima et al.
Nature, 395(6700), 395-398 (1998-10-06)
Autophagy is a process for the bulk degradation of proteins, in which cytoplasmic components of the cell are enclosed by double-membrane structures known as autophagosomes for delivery to lysosomes or vacuoles for degradation. This process is crucial for survival during
Takahiro Nemoto et al.
The Journal of biological chemistry, 278(41), 39517-39526 (2003-08-02)
Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes/vacuoles. The formation of autophagosomes involves a dynamic rearrangement of the membrane for which two ubiquitin-like modifications (the conjugation of Apg12p and the modification of a soluble form

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej