Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Dokumenty

AV53656

Sigma-Aldrich

Anti-LGALS8 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-Gal-8, Anti-Lectin, galactoside-binding, soluble, 8 (galectin 8), Anti-PCTA-1, Anti-PCTA1, Anti-Po66-CBP

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

39 kDa

reaktywność gatunkowa

dog, human, rabbit, bovine, horse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_006490

numer dostępu UniProt

O00214

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... LGALS8(3964)

Opis ogólny

LGALS8 (lectin, galactoside-binding, soluble, 8) encodes a protein that belongs to galectin family and is predominantly expressed in tumoral tissues and may be involved in integrin-like cell interactions.

The previously assigned protein identifier Q9BXC8 has been merged into O00214. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the C terminal region of human LGALS8

Zastosowanie

Anti-LGALS8 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Działania biochem./fizjol.

Gal-8 activates Rho signaling in TM cells and hence facilitates the regulation of cytoskeletal rearrangement in trabecular meshwork cells. Galectin-8 interacts with integrin and modulates its interaction with the extracellular matrix and hence inhibits cell adhesion and induces apoptosis. Additionally, it also has a role in modulating cell adhesion and cell growth.

Sekwencja

Synthetic peptide located within the following region: FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Shiri Diskin et al.
PloS one, 7(9), e44400-e44400 (2012-09-14)
The trabecular meshwork (TM) cell-matrix interactions and factors that influence Rho signaling in TM cells are thought to play a pivotal role in the regulation of aqueous outflow. The current study was designed to evaluate the role of a carbohydrate-binding
Yehiel Zick et al.
Glycoconjugate journal, 19(7-9), 517-526 (2004-02-06)
Galectin-8 belongs to the family of tandem-repeat type galectins. It consists as several isoforms, each made of two domains of approximately 140 amino-acids, both having a carbohydrate recognition domain (CRD). These domains are joined by a 'link peptide' of variable
Y R Hadari et al.
Journal of cell science, 113 ( Pt 13), 2385-2397 (2000-06-15)
The interaction of cells with the extracellular matrix regulates cell adhesion, motility, growth, survival and differentiation through integrin-mediated signal transduction. Here we demonstrate that galectin-8, a secreted mammalian (beta)-galactoside binding protein, inhibits adhesion of human carcinoma (1299) cells to plates

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej