AV48425

Anti-NUDCD1 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-CML66, Anti-FLJ14991, Anti-NudC domain containing 1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 2

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 67 kDa
• species reactivity: human, horse, mouse, rat, guinea pig, rabbit, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_116258
• UniProt accession no.: Q96RS6
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NUDCD1(84955)

Opis

General description

NUDCD1 (CML66) codes for an NUDCD1 domain containing protein that is expressed in the cytoplasm. This protein is mainly expressed in the testis and solid tumors. Studies have reported that it is an immunogenic tumor antigen which is associated with chronic myelogenous leukemia.
Rabbit Anti-NUDCD1 antibody recognizes canine, chicken, human, mouse, rat, and bovine NUDCD1.

Immunogen

Synthetic peptide directed towards the N terminal region of human NUDCD1

Application

Rabbit Anti-NUDCD1 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

NUDCD1 (CML66) contains 1 CS domain. It may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable