Przejdź do zawartości
Merck

AV48015

Anti-DKK1 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-DKK-1, Anti-Dickkopf homolog 1 (Xenopus laevis), Anti-SK

Zaloguj się, aby wyświetlić ceny organizacyjne i kontraktowe.

Wybierz wielkość

Informacje o tej pozycji

UNSPSC Code:
12352203

Kluczowe dokumenty

Wyświetl całą dokumentację
Pomoc techniczna
Potrzebujesz pomocy? Nasz zespół doświadczonych naukowców chętnie Ci pomoże.
Pozwól nam pomóc
Pomoc techniczna
Potrzebujesz pomocy? Nasz zespół doświadczonych naukowców chętnie Ci pomoże.
Pozwól nam pomóc

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

26 kDa

species reactivity

pig, guinea pig, bovine, horse, rabbit, zebrafish, sheep, human, rat, goat, canine, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_036374

UniProt accession no.

O94907

storage temp.

−20°C

Gene Information

human ... DKK1(22943)

General description

Dickkopf WNT signaling pathway inhibitor 1 (DKK1) may be involved in embryonic development. Studies in aortic endothelial cells have revealed that Dkk1 modulates endothelial-mesenchymal cells. Downregulation of DKK1 has been linked to colorectal tumorigenesis. Serum DKK1 has been identified has a diagnostic biomarker for hepatocellular carcinoma.
Rabbit Anti-DKK1 antibody recognizes bovine, chicken, zebrafish, pig, canine, mouse, rat, human, and rabbit DKK1.

Immunogen

The immunogen for anti-DKK1 antibody: synthetic peptide derected towards the C terminal of human DKK1

Application

Rabbit Anti-DKK1 antibody is suitable for western blot applications at a concentration of 2.5μg/ml

Physical form

Lyophilized from PBS buffer with 2% sucrose

Other Notes

Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Klasa składowania

10 - Combustible liquids

wgk

WGK 1

Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number
QC16085

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Wyszukaj dokument COA

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Qiujin Shen et al.
The Lancet. Oncology, 13(8), 817-826 (2012-06-29)
Hepatocellular carcinoma (HCC) is prevalent worldwide and improvements in timely and effective diagnosis are needed. We assessed whether measurement of Dickkopf-1 (DKK1) in serum could improve diagnostic accuracy for HCC. We analysed data for patients with HCC, chronic hepatitis B
Su-Li Cheng et al.
Arteriosclerosis, thrombosis, and vascular biology, 33(7), 1679-1689 (2013-05-21)
Endothelial cells (ECs) can undergo an endothelial-mesenchymal transition with tissue fibrosis. Wnt- and Msx2-regulated signals participate in arteriosclerotic fibrosis and calcification. We studied the impact of Wnt7, Msx2, and Dkk1, a Wnt7 antagonist, on endothelial-mesenchymal transition in primary aortic ECs.
Zebin Huang et al.
PloS one, 8(7), e70077-e70077 (2013-08-08)
We collected paired samples of tumor and adjacent normal colorectal tissues from 22 patients with colorectal carcinoma to compare the differences in the expression of lysine specific demethylase 1 (LSD1) in these two tissues. The results showed that in 19

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej