AV46887

Anti-TSPAN12 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-NET-2, Anti-TM4SF12, Anti-Tetraspanin 12
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 4

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 35 kDa
• species reactivity: mouse, dog, guinea pig, rat, bovine, horse, human, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_036470
• UniProt accession no.: O95859
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TSPAN12(23554)

Opis

Immunogen

Synthetic peptide directed towards the middle region of human TSPAN12

Application

Anti-LETM1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL.

Biochem/physiol Actions

TSPAN12 (tetraspanin 12) gene encodes a multi-pass membrane protein that belongs to tetraspanin family. TSPAN12 interacts with ADAM10 and stimulates its maturation and thereby facilitates ADAM10-dependent proteolysis of amyloid precursor protein (APP). In cancer cells, knockdown of TSPAN12 decreases membrane type-1 matrix metalloproteinase (MT1-MMP) proteolytic functions. Mutation in TSPAN12 gene results in autosomal-dominant familial exudative vitreoretinopathy.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 12 - Non Combustible Liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable