Przejdź do zawartości
Merck

AV46751

Sigma-Aldrich

Anti-VAMP5 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Vesicle-associated membrane protein 5 (Myobrevin)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

13 kDa

reaktywność gatunkowa

human

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... VAMP5(10791)

Immunogen

Synthetic peptide directed towards the middle region of human VAMP5

Zastosowanie

Anti-VAMP5 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL.

Działania biochem./fizjol.

VAMP5 (vesicle-associated membrane protein 5) gene encodes a 116 amino acid containing single-pass type IV membrane protein that belongs to the synaptobrevin family and the SNARE superfamily. It plays a pivotal role vesicle trafficking events that are associated with myogenesis like- myoblast fusion and/or GLUT4 trafficking. VAMP5 protein is localized in skeletal muscle, heart, spleen, lung, liver, and kidney tissue and facilitates the membrane trafficking in skeletal and cardiac muscle.

Sekwencja

Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Maiko Takahashi et al.
Histochemistry and cell biology, 139(4), 573-582 (2012-11-28)
Vesicle-associated membrane protein 5 (VAMP5) is a member of the SNARE protein family, which is generally thought to regulate the docking and fusion of vesicles with their target membranes. This study investigated the expression and localization of the VAMP5 protein.
Q Zeng et al.
Molecular biology of the cell, 9(9), 2423-2437 (1998-09-03)
cDNA clones encoding a novel protein (VAMP5) homologous to synaptobrevins/VAMPs are detected during database searches. The predicted 102-amino acid VAMP5 harbors a 23-residue hydrophobic region near the carboxyl terminus and exhibits an overall amino acid identity of 33% with synaptobrevin/VAMP1

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej