Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Dokumenty

AV45774

Sigma-Aldrich

Anti-PFKL antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-DKFZp686G1648, Anti-DKFZp686L2097, Anti-FLJ30173, Anti-FLJ40909, Anti-PFK-B, Anti-Phosphofructokinase, liver

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

64 kDa

reaktywność gatunkowa

rat, mouse, bovine, dog, guinea pig, horse, human

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_002617

numer dostępu UniProt

P17858

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... PFKL(5211)

Immunogen

Synthetic peptide directed towards the middle region of human PFKL

Działania biochem./fizjol.

Phosphofructokinase (PFK; ATP: D-fructose-6-phosphate 1-phosphotransferase), the key regulatory enzyme of glycolysis, is a tetrameric protein. Three structural loci encode three distinct PFK units, muscle (PFKM) liver (PFKL), and platelet (PFKP). Each subunit is encoded by a separate gene; except PFKL, which maps to chromosome 21.

Sekwencja

Synthetic peptide located within the following region: RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Not finding the right product?  

Try our Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

R M Kay et al.
The American journal of clinical nutrition, 30(2), 171-175 (1977-02-01)
Citrus pectin (15 g/day) was added for 3 weeks to metabolically controlled diets in nine subjects. Pectin was consumed with fruit and sugar as a gel in divided doses with meals. Plasma cholesterol concentrations were reduced by a mean of
A Elson et al.
The Biochemical journal, 299 ( Pt 2), 409-415 (1994-04-15)
The human liver-type subunit of the key glycolytic enzyme, phosphofructokinase (PFKL), is encoded by a gene residing on chromosome 21. This chromosome, when triplicated, causes the phenotypic expression of Down's syndrome (trisomy 21). Increased phosphofructokinase activity, a result of gene
Daniel B Graham et al.
Nature communications, 6, 7838-7838 (2015-07-22)
The phagocyte oxidative burst, mediated by Nox2 NADPH oxidase-derived reactive oxygen species, confers host defense against a broad spectrum of bacterial and fungal pathogens. Loss-of-function mutations that impair function of the Nox2 complex result in a life-threatening immunodeficiency, and genetic

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej