AV40249

Anti-SF3B1 antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-PRP10, Anti-SAP155, Anti-SF3b155, Anti-Splicing factor 3b, subunit 1, 155 kDa
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 143 kDa
• reaktywność gatunkowa: rabbit, goat, horse, guinea pig, human, mouse, bovine, rat, dog
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_036565
• numer dostępu UniProt: O75533
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SF3B1(23451)

Opis

Opis ogólny

Splicing factor 3b, subunit 1, 155 kDa (SF3B1, SAP155, PRP10) is a subunit of the splicing factor 3b protein complex, which along with splicing factor 3a and 12S RNA forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). SF3B1 is also a component of the minor U12-type spliceosome. Mutations of SF3B1have been linked to myelodysplastic syndromes (MDS) and chronic lymphocytic leukemia (CLL).

Specyficzność

Anti-SF3B1 (AB3) polyclonal antibody reacts with human, mouse, rat, chicken, canine, and zebrafish splicing factor 3b, subunit 1, 155 kDa proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human SF3B1

Zastosowanie

Anti-SF3B1 (AB3) polyclonal antibody is used to tag splicing factor 3b, subunit 1, 155 kDa for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of splicing factor 3b, subunit 1, 155 kDa in U2-snRNP and U12-type spliceosome formation and function.

Działania biochem./fizjol.

SF3B1 is subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron′s branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures.This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron′s branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Alternative splicing results in multiple transcript variants encoding different isoforms.

Sekwencja

Synthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 12 - Non Combustible Liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable