AV35855

Anti-ZP3 antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Zona pellucida glycoprotein 3 (sperm receptor)
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 3

Właściwości

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 47 kDa
• species reactivity: rabbit, bovine, horse, human
• concentration: 0.5 mg - 1 mg/mL

Opis

Immunogen

Synthetic peptide directed towards the C terminal region of human ZP3

Biochem/physiol Actions

ZP3 protein is a structural component of zona pellucida, an extracellular matrix that surrounds the oocyte and the early embryo. ZP3 mediates the binding and induction of the sperm acrosome reaction.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGATDLPGQEW

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable