AV35165

Anti-KCND3 antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Potassium voltage-gated channel, Shal-related subfamily, member 3
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 70 kDa
• reaktywność gatunkowa: rabbit, rat, guinea pig, human
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_004971
• numer dostępu UniProt: Q9UK17-2
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... KCND3(3752)

Opis

Opis ogólny

KCND3 is a voltage-gated potassium (K_v) channel that is involved in the repolarization of the action potential. Genetic alterations in KCND3 have been associated with Brugada syndrome and sudden unexplained death.
Rabbit Anti-KCND3 antibody recognizes human, mouse, rat, rabbit, and pig KCND3.

Immunogen

Synthetic peptide directed towards the middle region of human KCND3

Zastosowanie

Rabbit Anti-KCND3 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Działania biochem./fizjol.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND3 encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.

Sekwencja

Synthetic peptide located within the following region: KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable