Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

AV34600

Sigma-Aldrich

Anti-CBX8 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-Chromobox homolog 8 (Pc class homolog, Drosophila)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

43 kDa

reaktywność gatunkowa

human, guinea pig, rat

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_065700

numer dostępu UniProt

Q9HC52

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... CBX8(57332)

Opis ogólny

CBX8 is a polycomb group protein that associates with other proteins such as TIP60 and MLL-AF9. CBX8 also forms a part of the PRC1 complexes. It regulates fibroblast proliferation and cell survival. Furthermore, studies have reported that CBX8 is needed for MLL-AF9-induced transcription and leukemogenesis.
Rabbit Anti-CBX8 (AB1) antibody recognizes bovine, human, mouse, rat, and canine CBX8.

Immunogen

Synthetic peptide directed towards the middle region of human CBX8

Zastosowanie

Rabbit Anti-CBX8 (AB1) antibody can be used for western blot applications at a concentration of 0.25 μg/ml.

Działania biochem./fizjol.

CBX8 is one of the proteins homolog to the Polycomb group (PcG) proteins. They assemble to form large multiprotein complexes involved in gene silencing. Evidence suggests that PcG complexes are heterogeneous with respect to both protein composition and specific function.

Sekwencja

Synthetic peptide located within the following region: QCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGALDPNGTRVRH

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

12 - Non Combustible Liquids

Klasa zagrożenia wodnego (WGK)

WGK 2

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Jiaying Tan et al.
Cancer cell, 20(5), 563-575 (2011-11-19)
Chromosomal translocations involving the mixed lineage leukemia (MLL) gene lead to the development of acute leukemias. Constitutive HOX gene activation by MLL fusion proteins is required for MLL-mediated leukemogenesis; however, the underlying mechanisms remain elusive. Here, we show that chromobox
Nikolaj Dietrich et al.
The EMBO journal, 26(6), 1637-1648 (2007-03-03)
The Polycomb group (PcG) proteins are essential for embryogenesis, and their expression is often found deregulated in human cancer. The PcGs form two major protein complexes, called polycomb repressive complexes 1 and 2 (PRC1 and PRC2) whose function is to

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej