AV34006

Anti-BHLHB2 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Basic helix-loop-helix domain containing, class B, 2
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 45 kDa
• reaktywność gatunkowa: mouse, guinea pig, rat, human, horse
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_003661
• numer dostępu UniProt: O14503
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... BHLHB2(8553)

Opis

Immunogen

Synthetic peptide directed towards the middle region of human BHLHB2

Działania biochem./fizjol.

BHLHB2 is a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation.DEC1 encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation.DEC1 encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sekwencja

Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable