AV33096

Anti-HSPA1A antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Heat shock 70 kDa protein 1A
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 52 kDa
• reaktywność gatunkowa: bovine, goat, guinea pig, dog, human, sheep, rat, horse, rabbit, mouse; bovine, goat, human, dog, guinea pig, sheep, rat, horse, mouse, rabbit
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_005337
• numer dostępu UniProt: P08107
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... HSPA1A(3303)

Opis

Opis ogólny

Heat shock 70 kDa protein 1A (HSPA1A, eHSP70, HSP72) is an environmental stress-inducible extracellular/plasma circulating heat shock protein that interacts with effector cells of the innate immune system. HSPA1A promotes the proliferation of H22 hepatocarcinoma cells through TLR2 and TLR4 signaling. HSPAIA signaling via TLR4 may trigger O3-induced lung inflammation. HSPA1A and its in vivo antibodies may contribute to the development of atherosclerosis. HSPA1A may stimulate innate and adaptive proinflammatory immune responses.

Specyficzność

Rabbit polyclonal anti- HSPA1A antibody reacts with zebrafish, human, mouse, rat, Caenorhabditis elegans, and canine plasma circulating 70 kDa heat shock proteins.

Immunogen

Synthetic peptide directed towards the middle region of human HSPA1A

Zastosowanie

Rabbit polyclonal anti- HSPA1A antibody is used to tag plasma circulating 70 kDa heat shock protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of plasma circulating 70 kDa heat shock proteins in the activation of cells containing TLR2 and TLR4 receptors, the stimulation of proinflammatory immune responses and the development of atherosclerosis.

Działania biochem./fizjol.

HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.

Sekwencja

Synthetic peptide located within the following region: SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable