Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

AV32872

Sigma-Aldrich

Anti-ZBTB7C antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Zinc finger and BTB domain containing 7C

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

69 kDa

reaktywność gatunkowa

rat, horse, guinea pig, dog, rabbit, goat, human, mouse, bovine

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_001034449

numer dostępu UniProt

O73453

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... ZBTB7C(201501)

Powiązane kategorie

Opis ogólny

ZBTB7C is a zinc-finger protein that functions as a tumor suppressor. Decreased ZBTB7C expression has been linked to cervical carcinoma.
Rabbit Anti-ZBTB7C antibody recognizes rat, mouse, bovine, human, chicken, and canine ZBTB7C.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZBTB7C

Zastosowanie

Rabbit Anti-ZBTB7C antibody can be used for western blotting applications at a concentration of 5μg/ml.

Działania biochem./fizjol.

The function of Anti-ZBTB7C has not yet been determined.

Sekwencja

Synthetic peptide located within the following region: MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Xueying An et al.
Biomedical journal, 47(3), 100651-100651 (2023-08-11)
Dysregulation of long non-coding RNAs (lncRNAs) is an important component of tumorigenesis. Aberrant expression of lncRNA taurine upregulated gene 1 (lncTUG1) has been reported in various tumors; however, its precise role and key targets critically involved in osteosarcoma (OS) progression
Martina Schmitz et al.
PloS one, 7(6), e39632-e39632 (2012-07-05)
HPV DNA integration into the host genome is a characteristic but not an exclusive step during cervical carcinogenesis. It is still a matter of debate whether viral integration contributes to the transformation process beyond ensuring the constitutive expression of the
Johanna Sandgren et al.
Experimental & molecular medicine, 42(7), 484-502 (2010-06-11)
Epigenomic and genomic changes affect gene expression and contribute to tumor development. The histone modifications trimethylated histone H3 lysine 4 (H3K4me3) and lysine 27 (H3K27me3) are epigenetic regulators associated to active and silenced genes, respectively and alterations of these modifications

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej