Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

AV32060

Sigma-Aldrich

Anti-PCSK6 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Proprotein convertase subtilisin/kexin type 6

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

68 kDa

reaktywność gatunkowa

rabbit, dog, horse, human, mouse, pig, rat

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... PCSK6(5046)

Opis ogólny

PCSK6 is a proprotein convertase that processes inactive protein into their active forms. PCSK6 has been linked to handedness in dyslexic individuals and has also been implicated in malignant gliomas.
Rabbit Anti-PCSK6 antibody recognizes human, mouse, rat, and canine PCSK6.

Immunogen

Synthetic peptide directed towards the N terminal region of human PCSK6

Zastosowanie

Rabbit Anti-PCSK6 antibody can be used for western blot applications at a concentration of 2.5μg/ml.

Działania biochem./fizjol.

PCSK6 is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. This gene is thought to play a role in tumor progression.

Sekwencja

Synthetic peptide located within the following region: IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

12 - Non Combustible Liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

S Delic et al.
Neuropathology and applied neurobiology, 38(2), 201-212 (2011-07-05)
The molecular mechanisms underlying the infiltrative growth of glioblastomas, the most common primary tumours of the central nervous system in adults, are still poorly understood. We aimed to identify and functionally validate novel glioma invasion-associated candidate genes. Microarray-based expression analysis
Thomas S Scerri et al.
Human molecular genetics, 20(3), 608-614 (2010-11-06)
Approximately 90% of humans are right-handed. Handedness is a heritable trait, yet the genetic basis is not well understood. Here we report a genome-wide association study for a quantitative measure of relative hand skill in individuals with dyslexia [reading disability

Questions

Reviews

No rating value

Active Filters

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej