AV31493

Anti-KLF1 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-EKLF, Anti-Kruppel-like factor 1 (erythroid)
• NACRES: NA.41
• UNSPSC Code: 12352203
• Species reactivity: human
• Conjugate: unconjugated
• Application: WB
• Citations: 2

Właściwości

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 38 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_006554
• UniProt accession no.: Q13351
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... KLF1(10661)

Opis

General description

KFL1 is known to modulate BCL11A expression and can increase human γ-globin/β-globin expression ratios. Furthermore, KFL1 haploinsufficiency can cause hereditary persistence of fetal hemoglobin.
Rabbit Anti-KLF1 antibody recognizes bovine, pig, human, mouse, and rat KLF1.

Immunogen

Synthetic peptide directed towards the middle region of human KLF1

Application

Rabbit Anti-KLF1 antibody can be used for western blot assays at 1μg/ml.

Biochem/physiol Actions

KLF1 is a transcription factor, originally identified in this laboratory, which plays a crucial role as a transcriptional activator at the adult beta-globin locus.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: PKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAP

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable