AV38028

Anti-ELF4 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-E74-like factor 4 (ets domain transcription factor)
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 71 kDa
• reaktywność gatunkowa: human
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_001120669
• numer dostępu UniProt: Q99607
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ELF4(2000)

Opis

Opis ogólny

ETS transcription factors share a conserved DNA-binding "ETS" domain and include several oncoproteins that induce tumorigenesis when overexpressed. The ETS family member E74-like factor 4 (ELF4) controls the ERK-mediated proliferation and homing of CD8+ T cells via Krüppel-like factors KLF4 and KLF2. ELF4 increase quiescence in bone marrow endothelial cells by the deregulation of cyclin-dependent kinase-4 expression and enhances regeneration of sinusoidal blood vessels.

Specyficzność

Anti-ELF4 (AB1) polyclonal antibody reacts with bovine, human, mouse, rat, and canine E74-like factor 4 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human ELF4

Zastosowanie

Anti-ELF4 (AB1) polyclonal antibody is used to tag E74-like factor 4 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of E74-like factor 4 in the signaling and regulation of quiescence and proliferation of cells such at T-cells and endothelial cells.

Działania biochem./fizjol.

ELF4 contains 1 ETS DNA-binding domain and belongs to the ETS family. It is transcriptional activator that binds to DNA sequences containing the consensus 5′-WGGA-3′. It transactivates promoters of the hematopoietic growth factor genes CSF2, IL3, IL8, and of the bovine lysozyme gene. It acts synergistically with RUNX1 to transactivate the IL3 promoter and also transactivates the PRF1 promoter in natural killer (NK) cells. ELF4 plays a role in the development and function of NK and NK T-cells and in innate immunity.

Sekwencja

Synthetic peptide located within the following region: MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYS

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 2
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable