AV30649

Anti-MAP3K8 antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Mitogen-activated protein kinase kinase kinase 8
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 53 kDa
• reaktywność gatunkowa: rat, dog, bovine, human, horse
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_005195
• numer dostępu UniProt: P41279
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... MAP3K8(1326)

Opis

Opis ogólny

Mitogen-activated protein kinase kinase kinase 8/mitogen-activated protein-3-kinase 8 (MAP3K8) activates MAP kinase and JNK kinase pathways, activates IkappaB kinases (IKK) and induces nuclear NF-kappaB. MAP3K8 promotes the production of TNA-α and IL-2 during T-cell activation.

Rabbit polyclonal anti-MAP3K8 antibody reacts with bovine, mouse, rat, canine, human, and chicken mitogen-activated protein kinase kinase kinase 8/mitogen-activated protein-3-kinase 8 kinases.

Immunogen

Synthetic peptide directed towards the C terminal region of human MAP3K8

Zastosowanie

Rabbit Anti-MAP3K8 antibody can be used for western blot (2.5μg/ml) assays.

Rabbit polyclonal anti-MAP3K8 antibody is used to tag mitogen-activated protein kinase kinase kinase 8/mitogen-activated protein-3-kinase 8 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of mitogen-activated protein kinase kinase kinase 8/mitogen-activated protein-3-kinase 8 in MAP kinase and JNK kinase cell signaling.

Działania biochem./fizjol.

MAP3K8 is a member of the serine/threonine protein kinase family. This kinase can activate both the MAP kinase and JNK kinase pathways. This kinase was shown to activate IkappaB kinases, and thus induce the nuclear production of NF-kappaB. This kinase was also found to promote the production of TNF-alpha and IL-2 during T lymphocyte activation. Studies of a similar gene in rat suggested the direct involvement of this kinase in the proteolysis of NF-kappaB1,p105 (NFKB1). This gene may also utilize a downstream in-frame translation start codon, and thus produce an isoform containing a shorter N-terminus. The shorter isoform has been shown to display weaker transforming activity.

Sekwencja

Synthetic peptide located within the following region: PRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLY

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable