Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Dokumenty

AV100917

Sigma-Aldrich

Anti-CSDA (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Cold shock domain protein A

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

40 kDa

reaktywność gatunkowa

human, pig, horse, rabbit, bovine, dog

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_003642

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... CSDA(8531)

Immunogen

Synthetic peptide directed towards the C terminal region of human CSDA

Zastosowanie

Anti-CSDA (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Działania biochem./fizjol.

CSDA is a member of RNA-and DNA-binding cold-shock-domain (CSD) family that regulates the concentration of EGR1 to mediate luteinizing hormone β subunit transcription. It regulates Bcr-Abl effector, and also regulates cell proliferation and transformation in chronic myeloid leukemia.

Sekwencja

Synthetic peptide located within the following region: GPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNA

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Not finding the right product?  

Try our Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

D Sears et al.
Cell death & disease, 1, e93-e93 (2010-01-01)
One proposed strategy to suppress the proliferation of imatinib-resistant cells in chronic myeloid leukemia (CML) is to inhibit key proteins downstream of Bcr-Abl. The PI3K/Akt pathway is activated by Bcr-Abl and is specifically required for the growth of CML cells.
Wenming Pan et al.
Cell death and differentiation, 26(2), 291-305 (2018-05-18)
Hepatic ischemia/reperfusion injury (IRI) is a common cause of morbidity and mortality in liver transplantation settings and involves severe cell death and inflammatory responses. MicroRNA-191 has recently been reported to be abnormally expressed in hepatocellular carcinoma and other liver diseases
Theodore R Chauvin et al.
Biology of reproduction, 86(2), 53-53 (2011-11-05)
Gonadotropin-releasing hormone (GnRH), a hypothalamic neurohormone, regulates transcription of Lhb in gonadotrophs indirectly through transient induction and accumulation of EGR1, a zinc finger transcription factor. AlphaT3 and LbetaT2 cell lines model gonadotrophs at two distinct stages of development, prenatal and

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej