APREST91245

PrEST Antigen ATG16L2

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Synonim(y): ATG16B, FLJ00012, WDR80
• Kod UNSPSC: 12352202

Właściwości

• rekombinowane: expressed in E. coli
• Próba: >80% (SDS-PAGE)
• Postać: buffered aqueous solution
• masa cząsteczkowa: predicted mol wt 27 kDa
• oczyszczone przez: immobilized metal affinity chromatography (IMAC)
• stężenie: ≥0.5 mg/mL
• sekwencja immunogenna: LLATGGADRLIHLWNVVGSRLEANQTLEGAGGSITSVDFDPSGYQVLAATYNQAAQLWKVGEAQSKETLSGHKDKVTAAKFKLTRHQAVTGS
• Ensembl | numer dostępu dla gatunku człowiek: ENSG00000168010
• numer dostępu UniProt: Q8NAA4
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... ATG16L2(89849)

Opis

Opis ogólny

Recombinant protein fragment of Human ATG16L2 with N-terminal His₆ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.    

Zastosowanie

Blocking agent and positive assay control using corresponding antibodies.

Powiązanie

Corresponding Antibody HPA050312.

Postać fizyczna

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Uwaga dotycząca przygotowania

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Informacje prawne

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 2
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable