APREST74709

PrEST Antigen SST

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Synonim(y): SMST
• Kod UNSPSC: 12352202

Właściwości

• rekombinowane: expressed in E. coli
• Próba: >80% (SDS-PAGE)
• Postać: buffered aqueous solution
• masa cząsteczkowa: predicted mol wt 27 kDa
• oczyszczone przez: immobilized metal affinity chromatography (IMAC)
• stężenie: ≥0.5 mg/mL
• sekwencja immunogenna: APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKN
• Ensembl | numer dostępu dla gatunku człowiek: ENSG00000157005
• numer dostępu UniProt: P61278
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... SST(6750)

Opis

Opis ogólny

Recombinant protein fragment of Human SST with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Zastosowanie

Suitable as a blocking agent using corresponding antibodies.

Powiązanie

Corresponding Antibody HPA019472.

Postać fizyczna

Solution in 1 M urea-PBS, pH 7.4

Uwaga dotycząca przygotowania

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Informacje prawne

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 2
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable