HPA035787

Anti-TMPRSS2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-PRSS10
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA035787
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; recombinant expression; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
• UniProt-Hinterlegungsnummer: O15393
• Anwendung(en): research pathology
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TMPRSS2(7113)

Beschreibung

Allgemeine Beschreibung

Transmembrane serine protease 2 (TMPRSS2) belongs to the membrane-anchored serine proteases (MASP) family, which is mainly expressed in the prostate. The gene TMPRSS2 codes for a prostate-specific androgen-responsive protease. This multimeric protein TMPRSS2 consists of a serine protease domain, a scavenger receptor cysteine-rich (SRCR) domain, a low-density lipoprotein receptor class A (LDLRA) domain and a transmembrane domain. The TMPRSS2 gene is located on human chromosome 21q22.3.

Immunogen

transmembrane protease, serine 2

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-TMPRSS2 antibody produced in rabbit has been used for immunohistochemistry at a dilution of 1:200-1:500. It has also been used in western blotting at a working concentration of 0.04-0.4 μg/ml.

Biochem./physiol. Wirkung

Transmembrane serine protease 2 (TMPRSS2) expression level is related to prostate cancer progression. This protein stimulates diverse coronaviruses (CoVs), human metapneumovirus, parainfluenza virus and hepatitis C virus in cell culture. It might lead to a viral spread in the host. TMPRSS2-specific inhibitors exhibit a broad antiviral effect. TMPRSS2 cleaves and stimulates the influenza virus hemagglutinin (HA). It is employed for S protein priming and is known to inhibit the host cell entry of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST87138

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1