Proliferating cell nuclear antigen (PCNA), a nuclear protein, is expressed ubiquitously in mammals. This homotrimer protein is a doughnut-shaped molecule that is expressed at high levels in the thymus, bone marrow, fetal liver, and few cells of the small intestine and colon. PCNA is mainly located in the nucleus. The PCNA gene is a single-copy gene mapped to human chromosome 20p13.
면역원
Synthetic peptide directed towards the C terminal region of human PCNA
Proliferating cell nuclear antigen (PCNA) participates in DNA replication and repair. It acts as an auxiliary factor of polymerase δ. It plays a key role in the maturation of Okazaki fragments. It can be used as a prognostic and diagnostic marker in chronic lymphoid leukemia (CLL). High expression of PCNA protein is seen in breast and duodenal cancers.
서열
Synthetic peptide located within the following region: LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of inflammation research, 14, 7295-7313 (2022-01-08)
Acute-on-chronic liver failure (ACLF) is a critical disease with a high fatality rate. Immune dysfunction and inflammatory responses are key risk factors in ACLF. Pyroptosis is a form of programmed cell death characterized by the release of inflammatory cytokines, which
Colorectal cancer is the third most common cancer. Because curcumin (CUR) has anti-inflammatory and anticancer properties, research has been undertaken to indicate that nanocurcumin compounds can be used to treat a variety of cancers. CUR in nanoform has been found
Ovarian tissue cryopreservation and future transplantation is the only strategy to preserve the fertility of young female adolescent and prepubertal patients. The primary challenge to ovarian graft longevity is the substantial loss of primordial follicles during the period of ischaemia
The pathogenesis of Acute-on-chronic liver failure (ACLF) involves several forms of cell death, such as pyroptosis, apoptosis, and necroptosis, which consist of PANoptosis. To explore PANoptosis as a regulated cell death pathway in ACLF. Firstly, a bioinformatic strategy was used
Asian Pacific journal of cancer prevention : APJCP, 21(9), 2739-2750 (2020-09-29)
In search for a unique natural combination of highly active biological components for treatment against colon cancer, we used aqueous extract of Ascidia, Styela plicata (ASCex), a marine invertebrate depending on its richness of high levels of biologically active components