추천 제품
생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
50kDa
종 반응성
rabbit, human, horse, bovine, pig, dog
농도
0.5 mg - 1 mg/mL
기술
immunoblotting: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TUBB6(84617)
일반 설명
Tubulin, β 6 class V (TUBB6) is encoded by a multigene family.It is located on human chromosome 18p11.21.
면역원
Synthetic peptide directed towards the N terminal region of human TUBB6
생화학적/생리학적 작용
Tubulin, β 6 class V (TUBB6) expression expression is correlated with microtubule stability. TUBB6 expression decreases in most tumors. Mutation in TUBB6 leads to velopharyngeal dysfunction, bilateral ptosis and congenital non-progressive facial palsy.Increased production of TUBB6 causes complete disruption of microtubule network and lowers pyroptosis.
서열
Synthetic peptide located within the following region: QLERINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIF
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
A cellular genome-wide association study reveals human variation in microtubule stability and a role in inflammatory cell death
Salinas,, et al.
Molecular Biology of the Cell, 25(1), 76-86 (2014)
Disease-associated epigenetic changes in monozygotic twins discordant for schizophrenia and bipolar disorder
Dempster,, et al.
Human Molecular Genetics, 20(24), 4786-4796 (2011)
A TUBB6 mutation is associated with autosomal dominant non-progressive congenital facial palsy, bilateral ptosis and velopharyngeal dysfunction
Fazeli, W, et al.
Human Molecular Genetics, 26(20), 4055-4066 (2017)
Tumoral and tissue-specific expression of the major human beta-tubulin isotypes.
Leandro-Garcia LJ
Cytoskeleton (Hoboken, N.J.), 67(4), 214-223 (2010)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.