콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

SAB2107883

Sigma-Aldrich

Anti-BMP7 antibody produced in rabbit

IgG fraction of antiserum

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩538,458

₩538,458


예상 입고일2025년 8월 08일세부사항



크기 선택

보기 변경
100 μL
₩538,458

About This Item

UNSPSC 코드:
12352203
NACRES:
NA.43

₩538,458


예상 입고일2025년 8월 08일세부사항


생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

49kDa

종 반응성

mouse, guinea pig, rabbit, dog, sheep, bovine, rat, human

농도

0.5 mg - 1 mg/mL

기술

immunoblotting: suitable
immunohistochemistry: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... BMP7(655)

면역원

Synthetic peptide directed towards the N terminal region of human BMP7

생화학적/생리학적 작용

Bone morphogenetic protein- 7 (BMP-7) belongs to the transforming growth factor-β (TGF-β) superfamily. The gene encoding it is localized on human chromosome 20q13.
The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.

서열

Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Xiaoyang Lv et al.
BMC genetics, 20(1), 70-70 (2019-08-29)
Hu sheep, a unique Chinese breed with high reproductive performance, are also well known for their rare white lambskin in China. The quality of lambskin is affected by hair follicles, and dermal papilla cells are an important component of hair
TGF-beta superfamily members and ovarian follicle development.
Knight PG and Glister C
Reproduction (Cambridge, England), 132(2), 191-206 (2006)
BMP7 Gene involved in nonsyndromic orofacial clefts in Western Han Chinese.
Yu Q
Medicina Oral, patologia Oral y cirugia Bucal, 20(3), e298-e304 (2015)

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.