SAB2102685

Anti-VPS8 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-FLJ32099, Anti-KIAA0804, Anti-Vacuolar protein sorting 8 homolog (S. cerevisiae)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 162 kDa
• 종 반응성: dog, human, horse, rabbit, rat, bovine, guinea pig, mouse
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• UniProt 수납 번호: Q8N3P4
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... VPS8(23355)

설명

일반 설명

The previously assigned protein identifier B9EIQ1 has been merged into Q8N3P4. Full details can be found on the UniProt database.

면역원

Synthetic peptide directed towards the N terminal region of human VPS8

생화학적/생리학적 작용

VPS8 belongs to the VPS8 family. It contains 1 RING-type zinc finger and 1 WD repeat. The functions of VPS8 remain unknown.

서열

Synthetic peptide located within the following region: CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDDPTLAICNDSG

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable