SAB1404300

Monoclonal Anti-RASA1, (C-terminal) antibody produced in mouse

clone 1E6, purified immunoglobulin, buffered aqueous solution

• 동의어(들): CM-AVM, CMAVM, DKFZp434N071, GAP, PKWS, RASA, RASGAP, p120GAP, p120RASGAP
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1E6, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~37.11 kDa
• 종 반응성: human
• 기술: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• NCBI 수납 번호: NM_002890
• UniProt 수납 번호: P20936
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... RASA1(5921)

설명

일반 설명

The protein encoded by this gene is located in the cytoplasm and is part of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Alternative splicing results in two isoforms where the shorter isoform, lacking the N-terminal hydrophobic region but retaining the same activity, appears to be abundantly expressed in placental but not adult tissues. (provided by RefSeq)

면역원

RASA1 (NP_002881, 948 a.a. ~ 1047 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable