SAB1403063

Monoclonal Anti-KLF2 antibody produced in mouse

clone 1D1, purified immunoglobulin, buffered aqueous solution

• 동의어(들): LKLF
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 결합: unconjugated
• application: ELISA (i); WB
• 클론: 1D1, monoclonal
• 종 반응성: human
• citations: 5
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1D1, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~35.79 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_016270
• UniProt 수납 번호: Q9Y5W3
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... KLF2(10365)

설명

일반 설명

Kruppel like factor 2 (KLF2) is a tumor-suppressor gene, localized on human chromosome 19p13.11.

면역원

KLF2 (NP_057354, 263 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH

생화학적/생리학적 작용

Kruppel like factor 2 (KLF2) is crucial for lung functioning, cell differentiation, migration and tissue development. It modulates endothelial pro-inflammatory activation. The protein has roles in cardiovascular development and T-cell differentiation. Mutation in the gene encoding it has been associated with heritable pulmonary arterial hypertension.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable