콘텐츠로 건너뛰기
Merck
모든 사진(5)

주요 문서

SAB1402390

Sigma-Aldrich

Monoclonal Anti-VEGF antibody produced in mouse

clone 3F7, purified immunoglobulin, buffered aqueous solution

동의어(들):

MGC70609, VEGF, VEGF-A, VPF

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41
가격 및 재고 정보를 현재 이용할 수 없음 고객지원팀으로 연락바랍니다.

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

3F7, monoclonal

양식

buffered aqueous solution

분자량

antigen ~37.55 kDa

종 반응성

human

기술

capture ELISA: suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: suitable

동형

IgG2aκ

NCBI 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... VEGFA(7422)

일반 설명

The vascular endothelial growth factor (VEGF) gene is localized on human chromosome 6p21.3 and is thought to encode four different isoforms. It signals through the three receptors, that is, fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product. The protein is expressed in vascularized tissues.
This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. (provided by RefSeq)

면역원

VEGF (NP_003367, 27 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCEC

애플리케이션

Monoclonal Anti-VEGF antibody produced in mouse has been used in Western Blotting.

생화학적/생리학적 작용

Vascular endothelial growth factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates the proliferation and survival of endothelial cells. It promotes angiogenesis and vascular permeability. VEGF is involved in the induction of tumor metastasis and intraocular neovascular syndromes.Polymorphism in the gene encoding it is linked with diabetic retinopathy in type 2 diabetes.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Libin Ma et al.
International journal of molecular medicine, 46(1), 265-279 (2020-07-07)
The aim of the present study was to explore the mechanism by which Notch1‑small activating (sa)RNA restored androgen sensitivity in human metastatic castration‑resistant prostate cancer (CRPC). After transfection of Notch1‑saRNA‑1480 in PC3 cells, the expression of Notch1 and androgen receptor (AR) was
Yue Zhao et al.
Scientific reports, 6, 28627-28627 (2016-06-25)
The interaction between endothelial cells (ECs) and smooth muscle cells (SMCs) plays a critical role in the maintenance of vessel wall homeostasis. The X-box binding protein 1 (XBP1) plays an important role in EC and SMC cellular functions. However, whether
Preliminary study on decreasing the expression of FOXP3 with miR-155 to inhibit diffuse large B-cell lymphoma
Jincheng Z
Oncology Letters (2017)
A common polymorphism in the 5'-untranslated region of the VEGF gene is associated with diabetic retinopathy in type 2 diabetes
Awata T
Diabetes (2002)
Suppression of retinal neovascularization in vivo by inhibition of vascular endothelial growth factor (VEGF) using soluble VEGF-receptor chimeric proteins
Aiello LP
Proceedings of the National Academy of Sciences of the USA (1995)

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.