HPA041402

Anti-CARMIL2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-LRRC16C, Anti-RLTPR, Anti-Carmil2, Anti-Lrrc16c, Anti-Rgd motif, leucine rich repeats, tropomodulin domain and proline-rich containing
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA041402
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:50- 1:200
• 면역원 서열: EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... RLTPR(146206)

설명

일반 설명

The gene CARMIL2 (capping protein regulator and myosin 1 linker 2) is mapped to human chromosome 16q22.1. The encoded protein belongs to the CARMIL family of proteins. The protein has a noncanonical pleckstrin homology domain, a leucine-rich repeat domain, a helical homodimerization domain and a disordered region that contains the CBR (CP-binding region) and a proline-rich domain, which binds to class-I myosins. CARMIL2 is also referred to as RLTPR (RGD, leucine-rich repeat, tropomodulin and proline-rich-containing protein).

면역원

capping protein regulator and myosin 1 linker 2 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-RLTPR antibody produced in rabbit has been used in western blotting.

생화학적/생리학적 작용

CARMIL (capping protein regulator and myosin 1 linker) proteins are mainly involved in cell migration. CARMIL proteins interact with capping protein (CP). In migrating cells, CARMIL2 (also referred to as RLTPR) regulates cell polarity. It also interacts with vimentin intermediate filaments. CARMIL2 is needed for cell migration in wound healing and invadopodia-induced matrix degradation.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST82234

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable