콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

HPA020107

Sigma-Aldrich

Anti-PLCD1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

동의어(들):

Anti-1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1, Anti-PLC-III, Anti-PLC-delta-1, Anti-Phosphoinositide phospholipase C, Anti-Phospholipase C-delta-1

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩917,154

₩917,154


구입 가능 여부는 고객센터에 문의하십시오.


크기 선택

보기 변경
100 μL
₩917,154

About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41
결합:
unconjugated
application:
IHC
클론:
polyclonal
종 반응성:
human
citations:
6
기술:
immunohistochemistry: 1:20- 1:50

₩917,154


구입 가능 여부는 고객센터에 문의하십시오.

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunohistochemistry: 1:20- 1:50

면역원 서열

EAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQP

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PLCD1(5333)

일반 설명

Phospholipase C-δ1 (PLCD1) is an enzyme which is very sensitive to the changes in the levels of Ca2+. The gene encoding it is located on human chromosome 3p21.3-p22.

면역원

1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-PLCD1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

Phospholipase C-δ1 (PLCD1) hydrolyzes phosphatidylinositol-4, 5-bisphosphate to form inositol 1, 4, 5 trisphosphate (IP3) and diacylglycerol, which are secondary messengers. It is involved in different pathways concerned with calcium homeostasis and metabolism. PLCD1 has an effect on the progression of the cell cycle in breast cancer cells and mutations in the gene encoding it has been linked to hereditary leukonychia.[1] It has also been studied as a tumor suppressor gene for esophageal squamous cell carcinoma.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST74721

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Hina Mir et al.
European journal of dermatology : EJD, 22(6), 736-739 (2012-11-15)
Hereditary leukonychia or porcelain nails is a nail dystrophy characterized by whitening of the nail plates in all nails of the hands and feet. It may exhibit an autosomal recessive or autosomal dominant pattern of inheritance. Mutations in the gene
Tingxiu Xiang et al.
Cancer biology & therapy, 10(5), 520-527 (2010-07-27)
Chromosome 3p harbors multiple tumor-suppressor genes. PLCD1, located at 3p22, encodes an enzyme that mediates regulatory signaling of energy metabolism, calcium homeostasis and intracellular movement. We investigated the epigenetic alterations of PLCD1 and its tumor suppressor function in breast cancer.
Haixi Mu et al.
Experimental cell research, 332(2), 179-189 (2015-02-07)
Our previous study showed that PLCD1 significantly decreases cell proliferation and affects cell cycle progression in breast cancer cells. In the present study, we aimed to investigate its functional and molecular mechanisms, and whether or not can become a new
X-T Hu et al.
Oncogene, 28(26), 2466-2475 (2009-05-19)
Located at the important tumor suppressor locus, 3p22, PLCD1 encodes an enzyme that mediates regulatory signaling of energy metabolism, calcium homeostasis and intracellular movements. We identified PLCD1 as a downregulated gene in aerodigestive carcinomas through expression profiling and epigenetic characterization.
Maija Kiuru et al.
American journal of human genetics, 88(6), 839-844 (2011-06-15)
Hereditary leukonychia (porcelain nails or white nails) is a rare nail disorder with an unknown genetic basis. To identify variants in a gene underlying this phenotype, we identified four families of Pakistani origin showing features of hereditary leukonychia. All 20

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.