가격 및 재고 정보를 현재 이용할 수 없음
추천 제품
생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: suitable
면역원 서열
DSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TBX20(57057)
일반 설명
T-box transcription factor (TBX20) belongs to the T-box transcription factor family. It is expressed in the developing hearts of embryos in vertebrates and invertebrates. TBX20 contains a DNA-binding domain called the T-box domain and the gene encoding this protein is present on chromosome 7p14-p15.
면역원
T-box transcription factor TBX20 recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-TBX20 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence[1] and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)
Immunofluorescence (1 paper)
생화학적/생리학적 작용
T-box transcription factor (TBX20) activates cardiac gene expression by interacting with transcription factors NK2 homeobox 5 (Nkx2-5), GATA binding protein 4 (GATA4) and GATA binding protein 5 (GATA5). During endocardial differentiation, it specifically interacts with GATA5. TBX20 and other T-box genes and factors interact repressively. This is responsible for splitting of the myocardium into the chamber and non-chamber. It is an important event upon which all the subsequent morphogenesis activities depend. Based on the particular isoform expressed and cellular requirements, TBX20 can regulate transcription of target genes both positively and negatively. Its T-box DNA-binding domain associates specifically with the consensus DNA half site sequence defined for the brachyury (T) protein. TBX20 also interacts with homeodomain factor Nkx2-5 and zinc finger factor GATA4.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST70963.
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
Fiona A Stennard et al.
Developmental biology, 262(2), 206-224 (2003-10-11)
Tbx20 is a member of the T-box transcription factor family expressed in the forming hearts of vertebrate and invertebrate embryos. We report here analysis of Tbx20 expression during murine cardiac development and assessment of DNA-binding and transcriptional properties of Tbx20
Characterization of the human TBX20 gene, a new member of the T-Box gene family closely related to the Drosophila H15 gene.
M Meins
Genomics, 67(3), 317-332 (2000)
Fiona A Stennard et al.
Development (Cambridge, England), 132(10), 2451-2462 (2005-04-22)
The genetic hierarchies guiding lineage specification and morphogenesis of the mammalian embryonic heart are poorly understood. We now show by gene targeting that murine T-box transcription factor Tbx20 plays a central role in these pathways, and has important activities in
Yuelong Liu et al.
Human molecular genetics, 23(8), 2145-2156 (2013-12-03)
Haploinsufficiency for CHD7, an ATP-dependent nucleosome remodeling factor, is the leading cause of CHARGE syndrome. While congenital heart defects (CHDs) are major clinical features of CHARGE syndrome, affecting >75% of patients, it remains unclear whether CHD7 can directly regulate cardiogenic
Mengcheng Shen et al.
STAR protocols, 4(2), 102256-102256 (2023-04-29)
Cardiac pericytes are a critical yet enigmatic cell type within the coronary microvasculature. Since primary human cardiac pericytes are not readily accessible, we present a protocol to generate them from human induced pluripotent stem cells (hiPSCs). Our protocol involves several
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
