생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
62 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PRKAA1(5562)
일반 설명
PRKAA1 gene encodes the catalytic α-subunit of 5′ AMP-activated protein kinase (AMPK) that belongs to ser/thr protein kinase family and is localized both in the cytoplasm and in the nucleus. AMPK is a heterotrimeric complex consists of a catalytic α subunit and regulatory β and γ subunits.
면역원
Synthetic peptide directed towards the N terminal region of human PRKAA1
애플리케이션
Anti-PRKAA1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
생화학적/생리학적 작용
AMPK is a cellular energy sensor present in all eukaryotic cells. It is stimulated by high AMP and low ATP concentration and regulates the activities of a number of key metabolic enzymes through allosteric mechanism. Increasing concentrations of AMP during the energy shortage stimulates phosphorylation by an upstream protein kinase and inhibits dephosphorylation, resulting in activation of catabolic pathways and switching off of ATP-consuming biosynthetic pathways. PRKAA1 also facilitates the autophagy-mediated damaged mitochondria clearance for erythrocyte maturation and homeostasis. Additionally, AMPK phosphorylates TSC2 to protect cells from energy deprivation-induced apoptosis and regulates cell growth and survival.
서열
Synthetic peptide located within the following region: GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Elżbieta Sarnowska et al.
Postepy higieny i medycyny doswiadczalnej (Online), 67, 750-760 (2013-09-11)
AMP-activated protein kinase (AMPK) is one of the major energy sensor at both: cellular and whole body level. It exists as heterotrimer containing three subunits: the catalytic α subunit, β and regulatory γ. AMPK is localized both in the cytoplasm
Sukriti Krishan et al.
Journal of clinical pathology, 67(9), 758-763 (2014-06-05)
The PRKAA1 gene encodes the catalytic α-subunit of 5′ AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor that maintains energy homeostasis within the cell and is activated when the AMP/ATP ratio increases. When activated, AMPK increases catabolic processes
Ken Inoki et al.
Cell, 115(5), 577-590 (2003-12-04)
Mutations in either the TSC1 or TSC2 tumor suppressor gene are responsible for Tuberous Sclerosis Complex. The gene products of TSC1 and TSC2 form a functional complex and inhibit the phosphorylation of S6K and 4EBP1, two key regulators of translation.
Huaiping Zhu et al.
Autophagy, 10(9), 1522-1534 (2014-07-06)
AMP-activated protein kinase α1 knockout (prkaa1(-/-)) mice manifest splenomegaly and anemia. The underlying molecular mechanisms, however, remain to be established. In this study, we tested the hypothesis that defective autophagy-dependent mitochondrial clearance in prkaa1(-/-) mice exacerbates oxidative stress, thereby enhancing
Abubakar Wani et al.
Autophagy, 17(11), 3813-3832 (2021-01-07)
Alzheimer disease (AD) is usually accompanied by two prominent pathological features, cerebral accumulation of amyloid-β (Aβ) plaques and presence of MAPT/tau neurofibrillary tangles. Dysregulated clearance of Aβ largely contributes to its accumulation and plaque formation in the brain. Macroautophagy/autophagy is
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
