AV46114
Anti-APOBEC3B antibody produced in rabbit
affinity isolated antibody
동의어(들):
Anti-APOBEC1L, Anti-ARCD3, Anti-ARP4, Anti-Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B, Anti-DJ742C19.2, Anti-FLJ21201, Anti-PHRBNL, Anti-bK150C2.2
로그인조직 및 계약 가격 보기
크기 선택
100 μL
₩701,162
₩701,162
예상 입고일2025년 5월 22일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
모든 사진(3)
크기 선택
보기 변경
100 μL
₩701,162
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
₩701,162
예상 입고일2025년 5월 22일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
46 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... APOBEC3B(9582)
면역원
Synthetic peptide directed towards the N terminal region of human APOBEC3B
애플리케이션
Anti-APOBEC3B antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.
생화학적/생리학적 작용
APOBEC3B is a member of the cytidine deaminase gene family and encodes apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B. Endogenous APOBEC3B is a principal nuclear protein that facilitates the DNA C-to-U editing activity in breast cancer cell-line extracts. APOBEC3B exhibits antiviral activity against human T-cell leukemia virus type 1 (HTLV-1) and is a potent inhibitor of simian immunodeficiency virus (SIV) replication.
서열
Synthetic peptide located within the following region: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Qin Yu et al.
The Journal of biological chemistry, 279(51), 53379-53386 (2004-10-07)
In the human genome the apolipoprotein B mRNA-editing enzyme catalytic polypeptide (APOBEC)3 gene has expanded into a tandem array of genes termed APOBEC3A-G. Two members of this family, APOBEC3G and APOBEC3F, have been found to have potent activity against virion
Michael B Burns et al.
Nature, 494(7437), 366-370 (2013-02-08)
Several mutations are required for cancer development, and genome sequencing has revealed that many cancers, including breast cancer, have somatic mutation spectra dominated by C-to-T transitions. Most of these mutations occur at hydrolytically disfavoured non-methylated cytosines throughout the genome, and
Marcel Ooms et al.
Journal of virology, 86(11), 6097-6108 (2012-03-30)
The human APOBEC3 family consists of seven cytidine deaminases (A3A to A3H), some of which display potent antiretroviral activity against HIV-1 and other retroviruses. Studies that analyzed the effect of A3G on human T-lymphotropic virus type 1 (HTLV-1) infectivity resulted
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
